Lineage for d3ak8h_ (3ak8 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316478Species Salmonella enterica [TaxId:439842] [189595] (2 PDB entries)
  8. 2316486Domain d3ak8h_: 3ak8 H: [198882]
    automated match to d3ak8i_
    complexed with mg, so4

Details for d3ak8h_

PDB Entry: 3ak8 (more details), 1.25 Å

PDB Description: Crystal structure of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
PDB Compounds: (H:) DNA protection during starvation protein

SCOPe Domain Sequences for d3ak8h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak8h_ a.25.1.1 (H:) automated matches {Salmonella enterica [TaxId: 439842]}
nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta
ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv
rkaigeakdedtadiftaasrdldkflwfiesnie

SCOPe Domain Coordinates for d3ak8h_:

Click to download the PDB-style file with coordinates for d3ak8h_.
(The format of our PDB-style files is described here.)

Timeline for d3ak8h_: