Lineage for d3abkb1 (3abk B:1-90)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 protein domains)
  6. 2577345Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2577346Species Cow (Bos taurus) [TaxId:9913] [81454] (36 PDB entries)
  8. 2577363Domain d3abkb1: 3abk B:1-90 [198840]
    Other proteins in same PDB: d3abka_, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkb1

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3abkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abkb1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3abkb1:

Click to download the PDB-style file with coordinates for d3abkb1.
(The format of our PDB-style files is described here.)

Timeline for d3abkb1: