SCOPe 2.08: Domain d1ggbh1: 1ggb H:6-112

Lineage for d1ggbh1 (1ggb H:6-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
   SQ NA # part of Fab 28 against HIV-1 RT

8. Domain d1ggbh1: 1ggb H:6-112 [19875]
   Other proteins in same PDB: d1ggbh2, d1ggbh3, d1ggbl1, d1ggbl2
   part of Fab 50.1

Details for d1ggbh1

PDB Entry: 1ggb, 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

PDB Compounds: (H:) igg2a-kappa 50.1 fab (heavy chain)

SCOPe Domain Sequences for d1ggbh1:

Sequence; same for both SEQRES and ATOM records:

>d1ggbh1 b.1.1.1 (H:6-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
esgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkrynpsl
ksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

Timeline for d1ggbh1:

• d1ggbh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ggbh1 appears in SCOPe 2.07