Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries) Uniprot P80385 182-326! Uniprot P80385 23-181 |
Domain d2ya3e2: 2ya3 E:182-324 [198696] Other proteins in same PDB: d2ya3a1, d2ya3a2, d2ya3a3, d2ya3b_ automated match to d2v8qe1 complexed with amp, j7v |
PDB Entry: 2ya3 (more details), 2.5 Å
SCOPe Domain Sequences for d2ya3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ya3e2 d.37.1.1 (E:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]} fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv vdehdvvkgivslsdilqalvlt
Timeline for d2ya3e2:
View in 3D Domains from other chains: (mouse over for more information) d2ya3a1, d2ya3a2, d2ya3a3, d2ya3b_ |