Lineage for d2y69o1 (2y69 O:2-90)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1697048Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1697049Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1697094Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1697095Species Cow (Bos taurus) [TaxId:9913] [81454] (25 PDB entries)
  8. 1697111Domain d2y69o1: 2y69 O:2-90 [198671]
    Other proteins in same PDB: d2y69a_, d2y69b2, d2y69c_, d2y69d_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o2, d2y69p_, d2y69q_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
    automated match to d1v54b2
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69o1

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2y69o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69o1 f.17.2.1 (O:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev
etiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2y69o1:

Click to download the PDB-style file with coordinates for d2y69o1.
(The format of our PDB-style files is described here.)

Timeline for d2y69o1: