Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (4 PDB entries) |
Domain d1fvcb_: 1fvc B: [19863] |
PDB Entry: 1fvc (more details), 2.2 Å
SCOP Domain Sequences for d1fvcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvcb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain} evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdywgqgtlvtvss
Timeline for d1fvcb_: