SCOPe 2.07: Domain d2xgya_: 2xgy A:

Lineage for d2xgya_ (2xgy A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.0: automated matches [227254] (1 protein)
   not a true family

6. Protein automated matches [227039] (3 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225977] (1 PDB entry)

8. Domain d2xgya_: 2xgy A: [198606]
   Other proteins in same PDB: d2xgyb_
   automated match to d2xdea_
   complexed with gol

Details for d2xgya_

PDB Entry: 2xgy, 1.8 Å

PDB Description: complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a

PDB Compounds: (A:) relik capsid n-terminal domain

SCOPe Domain Sequences for d2xgya_:

Sequence, based on SEQRES records:

>d2xgya_ a.73.1.0 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
pimlrggrqeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtp
gfaaekqlvidkikekaiawdemhppppadaagpvpltsdqirgiglspeeaagprfada
rtlyrtwvlealqecqr

Sequence, based on observed residues (ATOM records):

>d2xgya_ a.73.1.0 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
pimeyepvgpgliaawlkqvqehglthpatityfgvisinftsvdinmllnvtpgaekql
vidkikekaiawdemhppppadaagpvpltsdqirgiglspeeaagprfadartlyrtwv
lealqecqr

Timeline for d2xgya_:

• d2xgya_ first appeared in SCOPe 2.03
  
• d2xgya_ appears in SCOPe 2.06
  
• d2xgya_ appears in the current release, SCOPe 2.08