Lineage for d2fb4l1 (2fb4 L:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741627Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)
  8. 2741629Domain d2fb4l1: 2fb4 L:1-109 [19846]
    Other proteins in same PDB: d2fb4h1, d2fb4h2, d2fb4l2
    part of Fab KOL

Details for d2fb4l1

PDB Entry: 2fb4 (more details), 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)
PDB Compounds: (L:) igg1-lambda kol fab (light chain)

SCOPe Domain Sequences for d2fb4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb4l1 b.1.1.1 (L:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlg

SCOPe Domain Coordinates for d2fb4l1:

Click to download the PDB-style file with coordinates for d2fb4l1.
(The format of our PDB-style files is described here.)

Timeline for d2fb4l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fb4l2