SCOPe 2.07: Domain d2qwqb_: 2qwq B:

Lineage for d2qwqb_ (2qwq B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
   Pfam PF00226

6. Protein Auxilin J-domain [88969] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88970] (7 PDB entries)

8. Domain d2qwqb_: 2qwq B: [198317]
   Other proteins in same PDB: d2qwqa1, d2qwqa2
   automated match to d1nz6b_
   complexed with acy, adp, gol, po4

Details for d2qwqb_

PDB Entry: 2qwq, 2.21 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the amppnp hydrolyzed form

PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwqb_:

Sequence; same for both SEQRES and ATOM records:

>d2qwqb_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv
vhpckatgqpyeqyakmifmelndawsefenq

Timeline for d2qwqb_:

• d2qwqb_ first appeared in SCOPe 2.03
  
• d2qwqb_ appears in SCOPe 2.06
  
• d2qwqb_ appears in the current release, SCOPe 2.08