Lineage for d2opra2 (2opr A:430-548)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495100Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2495120Domain d2opra2: 2opr A:430-548 [198211]
    Other proteins in same PDB: d2opra1, d2oprb_
    automated match to d1rtda1
    complexed with hbq; mutant

Details for d2opra2

PDB Entry: 2opr (more details), 2.9 Å

PDB Description: crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2opra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2opra2 c.55.3.0 (A:430-548) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqv

SCOPe Domain Coordinates for d2opra2:

Click to download the PDB-style file with coordinates for d2opra2.
(The format of our PDB-style files is described here.)

Timeline for d2opra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2opra1
View in 3D
Domains from other chains:
(mouse over for more information)
d2oprb_