SCOPe 2.07: Domain d2j5za_: 2j5z A:

Lineage for d2j5za_ (2j5z A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)

8. Domain d2j5za_: 2j5z A: [198090]
   automated match to d2j5zc_
   complexed with act, ca, gal

Details for d2j5za_

PDB Entry: 2j5z, 1.73 Å

PDB Description: h-ficolin complexed to galactose

PDB Compounds: (A:) ficolin-3

SCOPe Domain Sequences for d2j5za_:

Sequence; same for both SEQRES and ATOM records:

>d2j5za_ d.171.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqegprncrellsqgatlsgwyhlclpegralpvfcdmdtegggwlvfqrrqdgsvdffr
swssyragfgnqesefwlgnenlhqltlqgnwelrveledfngnrtfahyatfrllgevd
hyqlalgkfsegtagdslslhsgrpfttydadhdssnsncavivhgawwyascyrsnlng
ryavseaaahkygidwasgrgvghpyrrvrmmlr

Timeline for d2j5za_:

• d2j5za_ first appeared in SCOPe 2.03
  
• d2j5za_ appears in SCOPe 2.06
  
• d2j5za_ appears in the current release, SCOPe 2.08