Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d2h9ga2: 2h9g A:108-211 [197997] Other proteins in same PDB: d2h9ga1, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl1, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1 automated match to d1rhha2 |
PDB Entry: 2h9g (more details), 2.32 Å
SCOPe Domain Sequences for d2h9ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9ga2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2h9ga2: