SCOPe 2.07: Domain d2gbwe1: 2gbw E:6-152

Lineage for d2gbwe1 (2gbw E:6-152)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)

8. Domain d2gbwe1: 2gbw E:6-152 [197942]
   Other proteins in same PDB: d2gbwa2, d2gbwb_, d2gbwc2, d2gbwd_, d2gbwe2, d2gbwf_
   automated match to d1o7na1
   complexed with fe, fes, oxy

Details for d2gbwe1

PDB Entry: 2gbw, 1.7 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1

PDB Compounds: (E:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbwe1:

Sequence; same for both SEQRES and ATOM records:

>d2gbwe1 b.33.1.0 (E:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp

Timeline for d2gbwe1:

• d2gbwe1 first appeared in SCOPe 2.03
  
• d2gbwe1 appears in SCOPe 2.06
  
• d2gbwe1 appears in the current release, SCOPe 2.08