Class b: All beta proteins [48724] (178 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries) |
Domain d2gbwe1: 2gbw E:6-152 [197942] Other proteins in same PDB: d2gbwa2, d2gbwb_, d2gbwc2, d2gbwd_, d2gbwe2, d2gbwf_ automated match to d1o7na1 complexed with fe, fes, oxy |
PDB Entry: 2gbw (more details), 1.7 Å
SCOPe Domain Sequences for d2gbwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbwe1 b.33.1.0 (E:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]} tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn sldkqklaaksvrvetykgfifgchdp
Timeline for d2gbwe1: