SCOPe 2.08: Domain d2fjfs1: 2fjf S:1-107

Lineage for d2fjfs1 (2fjf S:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2fjfs1: 2fjf S:1-107 [197908]
   Other proteins in same PDB: d2fjfa2, d2fjfb_, d2fjfc2, d2fjfd_, d2fjfe2, d2fjff_, d2fjfg2, d2fjfh_, d2fjfi_, d2fjfj2, d2fjfk_, d2fjfl2, d2fjfm2, d2fjfn_, d2fjfo2, d2fjfp_, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2
   automated match to d1rhha1

Details for d2fjfs1

PDB Entry: 2fjf, 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab

PDB Compounds: (S:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfs1:

Sequence; same for both SEQRES and ATOM records:

>d2fjfs1 b.1.1.0 (S:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik

Timeline for d2fjfs1:

• d2fjfs1 first appeared in SCOPe 2.03
  
• d2fjfs1 appears in SCOPe 2.07