SCOPe 2.04: Domain d2bnsc2: 2bns C:36-247

Lineage for d2bnsc2 (2bns C:36-247)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d2bnsc2: 2bns C:36-247 [197796]
   Other proteins in same PDB: d2bnsa_, d2bnsb_, d2bnsc1
   automated match to d1qovh1
   complexed with bcl, bph, cl, fe2, mst, po4, u10

Details for d2bnsc2

PDB Entry: 2bns, 2.5 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, excited state

PDB Compounds: (C:) reaction centre protein h chain

SCOPe Domain Sequences for d2bnsc2:

Sequence; same for both SEQRES and ATOM records:

>d2bnsc2 b.41.1.1 (C:36-247) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapk

Timeline for d2bnsc2:

• d2bnsc2 first appeared in SCOPe 2.03
  
• d2bnsc2 appears in SCOPe 2.05
  
• d2bnsc2 appears in the current release, SCOPe 2.08