![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) automatically mapped to Pfam PF02780 |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries) Uniprot P21953 52-392 |
![]() | Domain d2bfbb2: 2bfb B:205-342 [197787] Other proteins in same PDB: d2bfba1, d2bfbb1 automated match to d1x7yb2 complexed with cl, gol, k, mn, mrd, tdp |
PDB Entry: 2bfb (more details), 1.77 Å
SCOPe Domain Sequences for d2bfbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfbb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d2bfbb2: