Lineage for d1qa9d_ (1qa9 D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450842Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)
  7. 450843Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)
  8. 450846Domain d1qa9d_: 1qa9 D: [19760]
    Other proteins in same PDB: d1qa9a_, d1qa9c_

Details for d1qa9d_

PDB Entry: 1qa9 (more details), 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors

SCOP Domain Sequences for d1qa9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa9d_ b.1.1.1 (D:) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens)}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

SCOP Domain Coordinates for d1qa9d_:

Click to download the PDB-style file with coordinates for d1qa9d_.
(The format of our PDB-style files is described here.)

Timeline for d1qa9d_: