SCOP 1.69: Domain d1qa9b_: 1qa9 B:

Lineage for d1qa9b_ (1qa9 B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)

8. Domain d1qa9b_: 1qa9 B: [19759]
   Other proteins in same PDB: d1qa9a_, d1qa9c_

Details for d1qa9b_

PDB Entry: 1qa9, 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors

SCOP Domain Sequences for d1qa9b_:

Sequence; same for both SEQRES and ATOM records:

>d1qa9b_ b.1.1.1 (B:) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens)}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

Timeline for d1qa9b_:

• d1qa9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qa9b_ appears in SCOP 1.67
  
• d1qa9b_ appears in SCOP 1.71
  
• d1qa9b_ appears in the current release, SCOPe 2.08