Lineage for d1qa9b_ (1qa9 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352544Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)
  7. 2352545Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)
  8. 2352547Domain d1qa9b_: 1qa9 B: [19759]
    Other proteins in same PDB: d1qa9a_, d1qa9c_

Details for d1qa9b_

PDB Entry: 1qa9 (more details), 3.2 Å

PDB Description: Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors
PDB Compounds: (B:) human cd58 protein

SCOPe Domain Sequences for d1qa9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa9b_ b.1.1.1 (B:) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

SCOPe Domain Coordinates for d1qa9b_:

Click to download the PDB-style file with coordinates for d1qa9b_.
(The format of our PDB-style files is described here.)

Timeline for d1qa9b_: