Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein CD2, first domain [48740] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries) |
Domain d1a6pa_: 1a6p A: [19748] |
PDB Entry: 1a6p (more details), 2.08 Å
SCOP Domain Sequences for d1a6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6pa_ b.1.1.1 (A:) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki knltrddsgtynvtvystngtrildkaldlrile
Timeline for d1a6pa_: