Lineage for d1a6pa_ (1a6p A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652039Protein CD2, first domain [48740] (2 species)
  7. 652046Species Rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)
  8. 652051Domain d1a6pa_: 1a6p A: [19748]

Details for d1a6pa_

PDB Entry: 1a6p (more details), 2.08 Å

PDB Description: engineering of a misfolded form of cd2
PDB Compounds: (A:) T-cell surface antigen cd2

SCOP Domain Sequences for d1a6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6pa_ b.1.1.1 (A:) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]}
gtvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlki
knltrddsgtynvtvystngtrildkaldlrile

SCOP Domain Coordinates for d1a6pa_:

Click to download the PDB-style file with coordinates for d1a6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1a6pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a6pb_