Lineage for d3ry1a_ (3ry1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805840Domain d3ry1a_: 3ry1 A: [197442]
    automated match to d1n9mc_
    complexed with mpd, mrd

Details for d3ry1a_

PDB Entry: 3ry1 (more details), 1.03 Å

PDB Description: wild-type core streptavidin at atomic resolution
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3ry1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ry1a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
ps

SCOPe Domain Coordinates for d3ry1a_:

Click to download the PDB-style file with coordinates for d3ry1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ry1a_: