Lineage for d4kwna_ (4kwn A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441678Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1441679Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1441680Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1441822Protein automated matches [190420] (8 species)
    not a true protein
  7. 1441838Species Momordica balsamina [TaxId:3672] [189375] (54 PDB entries)
  8. 1441858Domain d4kwna_: 4kwn A: [197343]
    automated match to d3s9qa_
    complexed with gol, nag

Details for d4kwna_

PDB Entry: 4kwn (more details), 1.8 Å

PDB Description: a new stabilizing water structure at the substrate binding site in ribosome inactivating protein from momordica balsamina at 1.80 a resolution
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4kwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwna_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4kwna_:

Click to download the PDB-style file with coordinates for d4kwna_.
(The format of our PDB-style files is described here.)

Timeline for d4kwna_: