Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein CD8 [48734] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48735] (2 PDB entries) |
Domain d1akje_: 1akj E: [19713] Other proteins in same PDB: d1akja1, d1akja2, d1akjb_ |
PDB Entry: 1akj (more details), 2.65 Å
SCOP Domain Sequences for d1akje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akje_ b.1.1.1 (E:) CD8 {Human (Homo sapiens)} sqfrvspldrtwnlgetvelkcqvllsnptsgcswlfqprgaaasptfllylsqnkpkaa egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa
Timeline for d1akje_:
View in 3D Domains from other chains: (mouse over for more information) d1akja1, d1akja2, d1akjb_, d1akjd_ |