Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein N-terminal domain of sialoadhesin [48732] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48733] (2 PDB entries) |
Domain d1qfob_: 1qfo B: [19709] |
PDB Entry: 1qfo (more details), 1.85 Å
SCOP Domain Sequences for d1qfob_:
Sequence, based on SEQRES records: (download)
>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus)} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt
>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus)} twgvsspknvqglsgscllipcifsypadvpvsgitaiwyydysgkrqvvihsgdpklvd krfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt
Timeline for d1qfob_: