SCOPe 2.04: Domain d3zloa_: 3zlo A:

Lineage for d3zloa_ (3zlo A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (34 PDB entries)

8. Domain d3zloa_: 3zlo A: [197063]
   automated match to d1g5ja_
   complexed with x8u

Details for d3zloa_

PDB Entry: 3zlo, 2.6 Å

PDB Description: crystal structure of bcl-xl in complex with inhibitor (compound 6)

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3zloa_:

Sequence, based on SEQRES records:

>d3zloa_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelry
rrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqv
lvsriaawmatylndhlepwiqenggwdtfvelygn

Sequence, based on observed residues (ATOM records):

>d3zloa_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqteseavkqalreagdefelryrrafsdltsqlhit
pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatyln
dhlepwiqenggwdtfvelygn

Timeline for d3zloa_:

• d3zloa_ first appeared in SCOPe 2.02
  
• d3zloa_ appears in SCOPe 2.03
  
• d3zloa_ appears in SCOPe 2.05
  
• d3zloa_ appears in the current release, SCOPe 2.08, called d3zloa1