Class b: All beta proteins [48724] (178 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186915] (26 PDB entries) |
Domain d4i9ya1: 4i9y A:2-164 [196904] Other proteins in same PDB: d4i9ya2, d4i9yb2, d4i9yc2, d4i9yd2, d4i9ye2, d4i9yf2 automated match to d1m9ea_ complexed with cl, gol, tla |
PDB Entry: 4i9y (more details), 1.75 Å
SCOPe Domain Sequences for d4i9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9ya1 b.62.1.1 (A:2-164) automated matches {Human (Homo sapiens) [TaxId: 9606]} tnpvvffdvcadgeplgritmelfsnivprtaenfralctgekgfgfknsifhrvipdfv cqggditkhdgtggqsiygdkfedenfdvkhtgpgllsmanqgqntnnsqfvitlkkaeh ldfkhvvfgfvkdgmdtvkkiesfgspkgsvcrrititecgqi
Timeline for d4i9ya1: