SCOPe 2.07: Domain d4i77z_: 4i77 Z:

Lineage for d4i77z_ (4i77 Z:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-13 (IL-13) [63532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)

8. Domain d4i77z_: 4i77 Z: [196843]
   Other proteins in same PDB: d4i77l1, d4i77l2
   automated match to d1ik0a_

Details for d4i77z_

PDB Entry: 4i77, 1.9 Å

PDB Description: Lebrikizumab Fab bound to IL-13

PDB Compounds: (Z:) interleukin-13

SCOPe Domain Sequences for d4i77z_:

Sequence, based on SEQRES records:

>d4i77z_ a.26.1.2 (Z:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
talrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrml
sgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfr

Sequence, based on observed residues (ATOM records):

>d4i77z_ a.26.1.2 (Z:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
talrelieelvnitqplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsgfc
phkvsagqfsslhvrdtkievaqfvkdlllhlkklfr

Timeline for d4i77z_:

• d4i77z_ first appeared in SCOPe 2.02
  
• d4i77z_ appears in SCOPe 2.06
  
• d4i77z_ appears in the current release, SCOPe 2.08