Lineage for d4empa_ (4emp A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1584363Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 1584477Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries)
  8. 1584513Domain d4empa_: 4emp A: [196834]
    automated match to d3qwdc_
    mutant

Details for d4empa_

PDB Entry: 4emp (more details), 2.7 Å

PDB Description: Crystal structure of the mutant of ClpP E137A from Staphylococcus aureus
PDB Compounds: (A:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4empa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4empa_ c.14.1.1 (A:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateiaiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

SCOPe Domain Coordinates for d4empa_:

Click to download the PDB-style file with coordinates for d4empa_.
(The format of our PDB-style files is described here.)

Timeline for d4empa_: