Lineage for d19hcb_ (19hc B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101664Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 101665Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 101666Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins)
  6. 101698Protein Nine-haem cytochrome c [48705] (2 species)
  7. 101699Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (1 PDB entry)
  8. 101701Domain d19hcb_: 19hc B: [19669]

Details for d19hcb_

PDB Entry: 19hc (more details), 1.8 Å

PDB Description: nine-haem cytochrome c from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d19hcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d19hcb_ a.138.1.1 (B:) Nine-haem cytochrome c {Desulfovibrio desulfuricans, ATCC 27774}
aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa

SCOP Domain Coordinates for d19hcb_:

Click to download the PDB-style file with coordinates for d19hcb_.
(The format of our PDB-style files is described here.)

Timeline for d19hcb_: