| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
| Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
| Domain d4il6u_: 4il6 U: [196656] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6v_, d4il6x_, d4il6z_ automated match to d3arcu_ complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d4il6u_: