Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) automatically mapped to Pfam PF00737 |
Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
Protein automated matches [191001] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries) |
Domain d4il6h_: 4il6 H: [196653] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_ automated match to d3bz2h_ complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs wka
Timeline for d4il6h_: