Lineage for d4il6h_ (4il6 H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026522Protein automated matches [191001] (5 species)
    not a true protein
  7. 3026534Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries)
  8. 3026539Domain d4il6h_: 4il6 H: [196653]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d3bz2h_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6h_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d4il6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d4il6h_:

Click to download the PDB-style file with coordinates for d4il6h_.
(The format of our PDB-style files is described here.)

Timeline for d4il6h_: