SCOP 1.59: Domain d1czj__: 1czj -

Lineage for d1czj__ (1czj -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)

5. Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins)

6. Protein Cytochrome c3 [48697] (5 species)

7. Species Desulfomicrobium norvegicum [TaxId:52561] [48702] (1 PDB entry)

8. Domain d1czj__: 1czj - [19663]

Details for d1czj__

PDB Entry: 1czj, 2.16 Å

PDB Description: cytochrome c of class iii (ambler) 26 kd

SCOP Domain Sequences for d1czj__:

Sequence; same for both SEQRES and ATOM records:

>d1czj__ a.138.1.1 (-) Cytochrome c3 {Desulfomicrobium norvegicum}
tfeipesvtmspkqfegytpkkgdvtfnhashmdiacqqchhtvpdtytiescmtegchd
nikerteissvyrtfhttkdsekscvgchrelkrqgpsdaplacnschvq

Timeline for d1czj__:

• d1czj__ first appeared (with stable ids) in SCOP 1.55
  
• d1czj__ appears in SCOP 1.57
  
• d1czj__ appears in SCOP 1.61
  
• d1czj__ appears in the current release, SCOPe 2.08, called d1czja_