![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries) |
![]() | Domain d3ftfa_: 3ftf A: [196592] automated match to d3tqsa_ protein/RNA complex; complexed with k, sah |
PDB Entry: 3ftf (more details), 2.8 Å
SCOPe Domain Sequences for d3ftfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ftfa_ c.66.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} mvrlkksfgqhllvsegvlkkiaeelnieegntvvevgggtgnltkvllqhplkklyvie ldremvenlksigderlevinedaskfpfcslgkelkvvgnlpynvasliientvynkdc vplavfmvqkevaeklqgkkdtgwlsvfvrtfydvnyvmtvpprffvpppkvqsaviklv knekfpvkdlknykkfltkifqnrrkvlrkkipeellkeaginpdarveqlsledffkly rlieds
Timeline for d3ftfa_: