Lineage for d3ftfa_ (3ftf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894496Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries)
  8. 2894503Domain d3ftfa_: 3ftf A: [196592]
    automated match to d3tqsa_
    protein/RNA complex; complexed with k, sah

Details for d3ftfa_

PDB Entry: 3ftf (more details), 2.8 Å

PDB Description: Crystal structure of A. aeolicus KsgA in complex with RNA and SAH
PDB Compounds: (A:) Dimethyladenosine transferase

SCOPe Domain Sequences for d3ftfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ftfa_ c.66.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mvrlkksfgqhllvsegvlkkiaeelnieegntvvevgggtgnltkvllqhplkklyvie
ldremvenlksigderlevinedaskfpfcslgkelkvvgnlpynvasliientvynkdc
vplavfmvqkevaeklqgkkdtgwlsvfvrtfydvnyvmtvpprffvpppkvqsaviklv
knekfpvkdlknykkfltkifqnrrkvlrkkipeellkeaginpdarveqlsledffkly
rlieds

SCOPe Domain Coordinates for d3ftfa_:

Click to download the PDB-style file with coordinates for d3ftfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ftfa_: