Lineage for d3irca_ (3irc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375406Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2375450Protein automated matches [190183] (10 species)
    not a true protein
  7. 2375451Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries)
  8. 2375454Domain d3irca_: 3irc A: [196530]
    automated match to d2jsfa1
    complexed with so4

Details for d3irca_

PDB Entry: 3irc (more details), 2.25 Å

PDB Description: crystal structure analysis of dengue-1 envelope protein domain iii
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d3irca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3irca_ b.1.18.4 (A:) automated matches {Dengue virus 1 [TaxId: 11053]}
gmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitan
pivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig

SCOPe Domain Coordinates for d3irca_:

Click to download the PDB-style file with coordinates for d3irca_.
(The format of our PDB-style files is described here.)

Timeline for d3irca_: