Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein automated matches [190183] (10 species) not a true protein |
Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries) |
Domain d3irca_: 3irc A: [196530] automated match to d2jsfa1 complexed with so4 |
PDB Entry: 3irc (more details), 2.25 Å
SCOPe Domain Sequences for d3irca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3irca_ b.1.18.4 (A:) automated matches {Dengue virus 1 [TaxId: 11053]} gmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitan pivtdkekpvnieaeppfgesyivvgagekalklswfkkgssig
Timeline for d3irca_: