Lineage for d2wtlf1 (2wtl F:2-159)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317704Species Mycobacterium tuberculosis [TaxId:83332] [196063] (3 PDB entries)
  8. 2317740Domain d2wtlf1: 2wtl F:2-159 [196492]
    Other proteins in same PDB: d2wtla2, d2wtlb2, d2wtlc2, d2wtld2, d2wtle2, d2wtlf2
    automated match to d3bkna_
    complexed with fe, unl, unx

Details for d2wtlf1

PDB Entry: 2wtl (more details), 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d2wtlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtlf1 a.25.1.0 (F:2-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrppt

SCOPe Domain Coordinates for d2wtlf1:

Click to download the PDB-style file with coordinates for d2wtlf1.
(The format of our PDB-style files is described here.)

Timeline for d2wtlf1: