Lineage for d1g72d_ (1g72 D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101588Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
  4. 101596Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family) (S)
  5. 101597Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein)
  6. 101598Protein Methanol dehydrogenase, light chain [48668] (2 species)
  7. 101606Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (2 PDB entries)
  8. 101608Domain d1g72d_: 1g72 D: [19628]
    Other proteins in same PDB: d1g72a_, d1g72c_

Details for d1g72d_

PDB Entry: 1g72 (more details), 1.9 Å

PDB Description: catalytic mechanism of quinoprotein methanol dehydrogenase: a theoretical and x-ray crystallographic investigation

SCOP Domain Sequences for d1g72d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g72d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian

SCOP Domain Coordinates for d1g72d_:

Click to download the PDB-style file with coordinates for d1g72d_.
(The format of our PDB-style files is described here.)

Timeline for d1g72d_: