Lineage for d3oafa_ (3oaf A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384491Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1384658Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1384698Species Human (Homo sapiens) [TaxId:9606] [53607] (61 PDB entries)
  8. 1384730Domain d3oafa_: 3oaf A: [196276]
    automated match to d3f91a_
    complexed with oag, so4; mutant

Details for d3oafa_

PDB Entry: 3oaf (more details), 1.7 Å

PDB Description: structural and kinetic data for antifolate interactions against pneumocystis jirovecii, pneumocystis carinii and human dihydrofolate reductase and thier active site mutants
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3oafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oafa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi
pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d3oafa_:

Click to download the PDB-style file with coordinates for d3oafa_.
(The format of our PDB-style files is described here.)

Timeline for d3oafa_: