Class a: All alpha proteins [46456] (144 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies) |
Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family) |
Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein) |
Protein Methanol dehydrogenase, light chain [48668] (2 species) |
Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (2 PDB entries) |
Domain d1g72b_: 1g72 B: [19627] Other proteins in same PDB: d1g72a_, d1g72c_ |
PDB Entry: 1g72 (more details), 1.9 Å
SCOP Domain Sequences for d1g72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g72b_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1} ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian
Timeline for d1g72b_: