Class a: All alpha proteins [46456] (226 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) interrupted alpha-helix |
Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
Protein Ribosomal protein L39e [48664] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries) |
Domain d1ffky_: 1ffk Y: [19624] Other proteins in same PDB: d1ffkb_, d1ffkd_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffky_:
Sequence, based on SEQRES records: (download)
>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Archaeon Haloarcula marismortui} gkkskatkkrkakldnqnsrvpayvmlktdrevqrnhkrrhwrrndtde
>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Archaeon Haloarcula marismortui} gkkskatkkrkakldnqnsrvpayvmlktde
Timeline for d1ffky_: