Lineage for d1ffky_ (1ffk Y:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544788Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 544789Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 544790Protein Ribosomal protein L39e [48664] (1 species)
  7. 544791Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 544796Domain d1ffky_: 1ffk Y: [19624]
    Other proteins in same PDB: d1ffkb_, d1ffkd_
    complexed with cd, k, mo3; mutant

Details for d1ffky_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffky_:

Sequence, based on SEQRES records: (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrkakldnqnsrvpayvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrkakldnqnsrvpayvmlktde

SCOP Domain Coordinates for d1ffky_:

Click to download the PDB-style file with coordinates for d1ffky_.
(The format of our PDB-style files is described here.)

Timeline for d1ffky_: