Lineage for d1ffky_ (1ffk Y:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6849Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)
  4. 6850Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
  5. 6851Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 6852Protein Ribosomal protein L39e [48664] (1 species)
  7. 6853Species Haloarcula marismortui [TaxId:2238] [48665] (1 PDB entry)
  8. 6854Domain d1ffky_: 1ffk Y: [19624]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_

Details for d1ffky_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffky_:

Sequence, based on SEQRES records: (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui}
gkkskatkkrkakldnqnsrvpayvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui}
gkkskatkkrkakldnqnsrvpayvmlktde

SCOP Domain Coordinates for d1ffky_:

Click to download the PDB-style file with coordinates for d1ffky_.
(The format of our PDB-style files is described here.)

Timeline for d1ffky_: