Lineage for d2xuza_ (2xuz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389887Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1389986Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 1390149Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 1390164Protein automated matches [190559] (2 species)
    not a true protein
  7. 1390165Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries)
  8. 1390168Domain d2xuza_: 2xuz A: [196239]
    automated match to d2whya_
    complexed with eb4, fe, peg, pg4, po4

Details for d2xuza_

PDB Entry: 2xuz (more details), 1.9 Å

PDB Description: Crystal structure of the triscatecholate siderophore binding protein FeuA from Bacillus subtilis complexed with Ferri-Enterobactin
PDB Compounds: (A:) Iron-uptake system-binding protein

SCOPe Domain Sequences for d2xuza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xuza_ c.92.2.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqnk

SCOPe Domain Coordinates for d2xuza_:

Click to download the PDB-style file with coordinates for d2xuza_.
(The format of our PDB-style files is described here.)

Timeline for d2xuza_: