Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) |
Family e.18.1.0: automated matches [191637] (1 protein) not a true family |
Protein automated matches [191173] (4 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [196117] (4 PDB entries) |
Domain d3rgwl_: 3rgw L: [196118] Other proteins in same PDB: d3rgws_ automated match to d3myrb_ complexed with f3s, f4s, mg, nfu, sf4 |
PDB Entry: 3rgw (more details), 1.5 Å
SCOPe Domain Sequences for d3rgwl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgwl_ e.18.1.0 (L:) automated matches {Ralstonia eutropha [TaxId: 381666]} sayatqgfnlddrgrrivvdpvtrieghmrcevnvdannvirnavstgtmwrglevilkg rdprdawafvericgvctgchalasvravenaldiripknahlireimaktlqvhdhavh fyhlhaldwvdvmsalkadpkrtselqqlvspahplssagyfrdiqnrlkrfvesgqlgp fmngywgskayvlppeanlmavthylealdlqkewvkihtifggknphpnylvggvpcai nldgigaasapvnmerlsfvkarideiiefnknvyvpdvlaigtlykqagwlyggglaat nvldygeypnvaynkstdqlpggailngnwdevfpvdprdsqqvqefvshswykyadesv glhpwdgvtepnyvlgantkgtrtrieqidesakyswiksprwrghamevgplsryilay aharsgnkyaerpkeqleysaqminsaipkalglpetqytlkqllpstigrtlaralesq ycgemmhsdwhdlvaniragdtatanvdkwdpatwplqakgvgtvaaprgalghwirikd grienyqcvvpttwngsprdykgqigafeaslmntpmvnpeqpveilrtlhsfdpclacs th
Timeline for d3rgwl_: