Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [188499] (5 PDB entries) |
Domain d3ed5a_: 3ed5 A: [195946] automated match to d3i76b_ complexed with fmt |
PDB Entry: 3ed5 (more details), 1.72 Å
SCOPe Domain Sequences for d3ed5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ed5a_ c.108.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegk mtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyi vtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliig dsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnient
Timeline for d3ed5a_: