Lineage for d4dzta_ (4dzt A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1366720Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1366721Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1367016Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 1367017Protein automated matches [190500] (6 species)
    not a true protein
  7. 1367029Species Thermus aquaticus [TaxId:271] [195744] (1 PDB entry)
  8. 1367030Domain d4dzta_: 4dzt A: [195745]
    automated match to d2b6na_
    complexed with ca, pms

Details for d4dzta_

PDB Entry: 4dzt (more details), 1.95 Å

PDB Description: Aqualysin I: the crystal structure of a serine protease from an extreme thermophile, Thermus aquaticus YT-1
PDB Compounds: (A:) Aqualysin-1

SCOPe Domain Sequences for d4dzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dzta_ c.41.1.0 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
atqspapwgldridqrdlplsnsytytatgrgvnvyvidtgirtthrefggrarvgydal
ggngqdcnghgthvagtiggvtygvakavnlyavrvldcngsgstsgviagvdwvtrnhr
rpavanmslgggvstaldnavknsiaagvvyavaagndnanacnysparvaealtvgatt
ssdarasfsnygscvdlfapgasipsawytsdtatqtlngtsmatphvagvaalyleqnp
satpasvasailngattgrlsgigsgspnrllysll

SCOPe Domain Coordinates for d4dzta_:

Click to download the PDB-style file with coordinates for d4dzta_.
(The format of our PDB-style files is described here.)

Timeline for d4dzta_: