Lineage for d4dwfa1 (4dwf A:13-90)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539638Domain d4dwfa1: 4dwf A:13-90 [195743]
    Other proteins in same PDB: d4dwfa2, d4dwfb2
    automated match to d1wx9a1
    complexed with so4

Details for d4dwfa1

PDB Entry: 4dwf (more details), 1.8 Å

PDB Description: crystal structure of a hla-b associated transcript 3 (bat3) from homo sapiens at 1.80 a resolution
PDB Compounds: (A:) HLA-B-associated transcript 3

SCOPe Domain Sequences for d4dwfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwfa1 d.15.1.1 (A:13-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkkl
qeynvggkvihlverapp

SCOPe Domain Coordinates for d4dwfa1:

Click to download the PDB-style file with coordinates for d4dwfa1.
(The format of our PDB-style files is described here.)

Timeline for d4dwfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dwfa2