Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins) Pfam PF03654 |
Protein Multifunctional enzyme TcmN, cyclase/aromatase domain [160740] (1 species) |
Species Streptomyces glaucescens [TaxId:1907] [160741] (4 PDB entries) Uniprot P16559 1-152! Uniprot P16559 1-155 |
Domain d3tvqa_: 3tvq A: [195656] automated match to d2rera1 complexed with dqh |
PDB Entry: 3tvq (more details), 1.67 Å
SCOPe Domain Sequences for d3tvqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvqa_ d.129.3.6 (A:) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} maartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpdang rvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpgapf dnahmtahlntttranmerikkiiedrhregq
Timeline for d3tvqa_: