Lineage for d3qx1a1 (3qx1 A:571-650)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2539808Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2539828Protein automated matches [191298] (1 species)
    not a true protein
  7. 2539829Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)
  8. 2539830Domain d3qx1a1: 3qx1 A:571-650 [195453]
    Other proteins in same PDB: d3qx1a2, d3qx1b2
    automated match to d1h8ca_
    complexed with so4

Details for d3qx1a1

PDB Entry: 3qx1 (more details), 1.6 Å

PDB Description: Crystal structure of FAF1 UBX domain
PDB Compounds: (A:) fas-associated factor 1

SCOPe Domain Sequences for d3qx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qx1a1 d.15.1.2 (A:571-650) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
ksllevklfpqetlfleake

SCOPe Domain Coordinates for d3qx1a1:

Click to download the PDB-style file with coordinates for d3qx1a1.
(The format of our PDB-style files is described here.)

Timeline for d3qx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qx1a2