SCOPe 2.07: Domain d3utyb_: 3uty B:

Lineage for d3utyb_ (3uty B:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein Bacteriorhodopsin [56871] (3 species)
   a light-driven proton pump

7. Species Halobacterium sp. [TaxId:64091] [346420] (7 PDB entries)

8. Domain d3utyb_: 3uty B: [195402]
   automated match to d1cwqa_
   complexed with d12, ret; mutant

Details for d3utyb_

PDB Entry: 3uty, 2.37 Å

PDB Description: Crystal structure of bacteriorhodopsin mutant P50A/T46A

PDB Compounds: (B:) bacteriorhodopsin

SCOPe Domain Sequences for d3utyb_:

Sequence; same for both SEQRES and ATOM records:

>d3utyb_ f.13.1.1 (B:) Bacteriorhodopsin {Halobacterium sp. [TaxId: 64091]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaiatlvaaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d3utyb_:

• d3utyb_ first appeared in SCOPe 2.02
  
• d3utyb_ appears in SCOPe 2.06
  
• d3utyb_ appears in the current release, SCOPe 2.08