SCOPe 2.03: Domain d3b0ob_: 3b0o B:

Lineage for d3b0ob_ (3b0o B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)

8. Domain d3b0ob_: 3b0o B: [195182]
   automated match to d1hmla_
   complexed with ca

Details for d3b0ob_

PDB Entry: 3b0o, 1.61 Å

PDB Description: Crystal structure of alpha-lactalbumin

PDB Compounds: (B:) alpha-lactalbumin

SCOPe Domain Sequences for d3b0ob_:

Sequence; same for both SEQRES and ATOM records:

>d3b0ob_ d.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc

Timeline for d3b0ob_:

• d3b0ob_ first appeared in SCOPe 2.02
  
• d3b0ob_ appears in SCOPe 2.04
  
• d3b0ob_ appears in the current release, SCOPe 2.08, called d3b0ob1