![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
![]() | Protein automated matches [191036] (17 species) not a true protein |
![]() | Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries) |
![]() | Domain d3shdh_: 3shd H: [195041] automated match to d3dkud_ complexed with mn, so4 |
PDB Entry: 3shd (more details), 2.5 Å
SCOPe Domain Sequences for d3shdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3shdh_ d.113.1.0 (H:) automated matches {Escherichia coli [TaxId: 405955]} mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs plvaesircyqsgqryplemigdfnwpftk
Timeline for d3shdh_: